Protein Info for Psyr_2322 in Pseudomonas syringae pv. syringae B728a

Annotation: YD repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 913 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF25023: TEN_YD-shell" amino acids 22 to 158 (137 residues), 47.7 bits, see alignment E=7e-17 amino acids 184 to 369 (186 residues), 39.7 bits, see alignment E=1.8e-14 amino acids 462 to 644 (183 residues), 50.6 bits, see alignment E=9.2e-18 PF05593: RHS_repeat" amino acids 31 to 70 (40 residues), 25.9 bits, see alignment (E = 1.1e-09) amino acids 77 to 108 (32 residues), 25.2 bits, see alignment (E = 1.7e-09) amino acids 118 to 154 (37 residues), 24.5 bits, see alignment (E = 3e-09) amino acids 249 to 286 (38 residues), 34.5 bits, see alignment (E = 2.1e-12) amino acids 291 to 325 (35 residues), 40.2 bits, see alignment (E = 3.3e-14) TIGR01643: YD repeat (two copies)" amino acids 50 to 71 (22 residues), 18.1 bits, see alignment (E = 2.9e-07) amino acids 55 to 91 (37 residues), 25.3 bits, see alignment (E = 1.6e-09) amino acids 118 to 155 (38 residues), 24.7 bits, see alignment (E = 2.4e-09) amino acids 187 to 226 (40 residues), 17.1 bits, see alignment (E = 6.3e-07) amino acids 249 to 289 (41 residues), 28.7 bits, see alignment (E = 1.3e-10) amino acids 291 to 321 (31 residues), 28.8 bits, see alignment (E = 1.2e-10) amino acids 345 to 373 (29 residues), 18.4 bits, see alignment (E = 2.3e-07) TIGR03696: RHS repeat-associated core domain" amino acids 719 to 787 (69 residues), 77.8 bits, see alignment 7.3e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2322)

Predicted SEED Role

"FIG00954680: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU10 at UniProt or InterPro

Protein Sequence (913 amino acids)

>Psyr_2322 YD repeat protein (Pseudomonas syringae pv. syringae B728a)
MTVSFLRKAAVGIACAWLACSAQAGTISRTYTALGQVASIDGARTDVNDVTQYAYDAQGN
LTTVTNALGQVYALASFDSYGNPQSITDPNGVMTTLSYTPQGWLASLTIDSSTTQYAYNE
VGDLLQVTTADGNWVKYSYDDARRLIGVRNRLGESINYTLDPMGNRTAERTKDANGAVVH
LQRRVFDELGRLIRVVGAGDQTQRYGYDLNDNQSSDTTPRNNKTQQAFDALNRVSKIVDP
LQGVTALGYNSDDKVTKVVDPRGVTTLYTYDSLGNRISSKSPDGGTSTYAYDEANNLIRS
TDARGVVTEYAYDALNRLTSKSYPATPALNIKFLYDQTADGNLGIGHLTGLQDSAGVLTY
TYDAKGNLVRQHRSVGVNSGDYYETLNYGYDAARNLVQIGYPSNINLTFTRNSAAQVTGV
KLAIGNKTATLASNISYQPFGPVNSLTWGNGILLSRTYDQDYQLTQQQVGNWQTTYRYDA
DSNISETATSLWGAVQYEYDALGRLTQEQTNSVKKAYSFDATGNRTQRTTTNLTTSDATE
TQSLTYASDSNRVTSINGSTLPVDAAGNHTQINGRRFTYDSQGRLSEVYQANIYKIADYK
YNALGQRIIKRAYVMGSQALAGTTTYLYDPSGKLIGQTLYDGNGQKTSGQYWFWLDNMPL
AQLTANFSTLGEVSSSKLIYLHVDHLNTPRLATDSSQALLWRWNSDAYGVGSPEEDVDGD
GKATTIALRFPGQIYDAQTQLSYNYYRDYNPDTGRYVQSDPIGLGGGLNTYAYVNANPMS
FIDPMGLAATALPTWFDSIPDLIPQVGRGVGLGFGAGVSCLLYSPTLGNGECPPGGCYYS
ESAENSADQPDENNLDKLSSNKAADAAAREAGYEDAHDAKKGEGDSKVNIYNDKTTGFKW
LWNGKSGSSKNPL