Protein Info for Psyr_2301 in Pseudomonas syringae pv. syringae B728a

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 2 to 191 (190 residues), 112.4 bits, E=3e-36
• PF08659: KR
  • amino acids 4 to 184 (181 residues), 33.1 bits, E=8.1e-12
• PF13561: adh_short_C2
  • amino acids 8 to 193 (186 residues), 78.3 bits, E=1e-25

Best Hits

Swiss-Prot: 37% identical to Y2073_MYCTU: Uncharacterized oxidoreductase Rv2073c (Rv2073c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to psb:Psyr_2301)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

• D-sorbitol degradation II (1/1 steps found)
• L-sorbose degradation (1/2 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Fructose and mannose metabolism
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.1.1.140

Use Curated BLAST to search for 1.-.-.- or 1.1.1.140

Sequence Analysis Tools

See Q4ZU28 at UniProt or InterPro

Protein Sequence (246 amino acids)

>Psyr_2301 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a)
MKKILIIGATSTIAHACARRWATQGCDFFLVARNTDKLVSNAADLRARGAGHVDTYQMDV
THFSEHPAMLADCLAVLQQIDVVLLAHGTLPDQKACEQNAGLAVQEFITNGASVIALLTV
LARQFEVQRCGTLAVISSVAGDRGRPSNYLYGSAKAAVSTFCDGLQARMFKLGVHVVTIK
PGFVDTPMTRGLPLPAWLVAQPEDVAERIVNGIARQSTSLYAPGFWAWIMWVIRSIPQPL
FKRLNL