Protein Info for Psyr_2297 in Pseudomonas syringae pv. syringae B728a

Annotation: glucose 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00106: adh_short" amino acids 8 to 208 (201 residues), 188.7 bits, see alignment E=1.3e-59 PF08659: KR" amino acids 11 to 180 (170 residues), 57.3 bits, see alignment E=3e-19 PF13561: adh_short_C2" amino acids 14 to 257 (244 residues), 222.1 bits, see alignment E=1.2e-69

Best Hits

Swiss-Prot: 45% identical to DHG2_BACSU: Glucose 1-dehydrogenase 2 (ycdF) from Bacillus subtilis (strain 168)

KEGG orthology group: K00034, glucose 1-dehydrogenase [EC: 1.1.1.47] (inferred from 100% identity to psb:Psyr_2297)

Predicted SEED Role

"Glucose 1-dehydrogenase (EC 1.1.1.47)" in subsystem D-gluconate and ketogluconates metabolism or Entner-Doudoroff Pathway (EC 1.1.1.47)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU32 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Psyr_2297 glucose 1-dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MHISLKQQVAIVTGASSGLGAGAARALAEAGAAVVINYNSKPEPAEKLAEEIRAAGGKAL
AVGADVSKEEDVERLFAKTIEHFGALDILVANSGLQKDASIVDMSLEDWNTVINVNLTGQ
FLCARAALRQFIKQGMRPEVSRAMGKIIHMSSVHQLIPWAGHVNYAASKGGVDLLMRSIA
QEVGELKIRVNSVAPGAIRTPINADARKGDAEKEMLKLIPYGRIGEPEDVANAVLWLASD
ASDYVHGTTLFIDGGMTLYPEFRGNG