Protein Info for Psyr_2295 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter, transmembrane region:ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 603 signal peptide" amino acids 1 to 47 (47 residues), see Phobius details transmembrane" amino acids 70 to 92 (23 residues), see Phobius details amino acids 148 to 171 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details PF00005: ABC_tran" amino acids 373 to 528 (156 residues), 112 bits, see alignment E=3.6e-36

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 100% identity to psb:Psyr_2295)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU34 at UniProt or InterPro

Protein Sequence (603 amino acids)

>Psyr_2295 ABC transporter, transmembrane region:ABC transporter (Pseudomonas syringae pv. syringae B728a)
MPVFKRFISFMQQALRAMHLVWTTSRALSIGLIVATLIAGLLPALAAWLGQRIVDAVVAA
MQLHASAGEAPLWPVLRYVLFEAGVLALLAAAQRGLSVQQALLRVLLGQKVNTLILEKAQ
TLSLSQFEDSEFYDKLVRVRREASTRPLALVTKSLGLLQNLISLISFAVLLVHFSPWALL
ILVLGALPVFFAEAHFSGDAFRLFTRRAPETRRQNYIETLLSHEGYIKEVKLFGFAPLLL
KRYRDTFERLYAEDRRLTVRRDGWGFLLGLLGTAAFYLAYAWVVVDAVHGRITLGQMTMY
LVLFKQGQAAVSSSLSAISGLYEDGLYLADLYVYLGQPVTPSAGSLTVGAQPGDGMRFEN
VSFTYPGTSRPALENIDLHLAPGRSVALVGENGSGKTTLIKLLTRLYQPDQGRILLDGSD
LQEWDEEALRSRIGVIFQDFIRYQFLVGENLGVGDTQAFHDEGRWREAAAQGMAAQFIEQ
LDNGYATQLGRWFAGGQELSGGQWQKIALSRAYMRRDADILILDEPTAALDAGAEAAVFE
HFREYAKGRMTLLISHRFSSVRNAEHIVVLEHGRVLERGDHDSLIAAAGRYAALFDLQAQ
GYR