Protein Info for Psyr_2291 in Pseudomonas syringae pv. syringae B728a

Annotation: Class II aldolase/adducin, N-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF00596: Aldolase_II" amino acids 35 to 215 (181 residues), 164.6 bits, see alignment E=1.2e-52

Best Hits

Swiss-Prot: 51% identical to Y1201_CAUVC: Putative aldolase class 2 protein CC_1201 (CC_1201) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2291)

Predicted SEED Role

"Ribulose-5-phosphate 4-epimerase and related epimerases and aldolases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU38 at UniProt or InterPro

Protein Sequence (271 amino acids)

>Psyr_2291 Class II aldolase/adducin, N-terminal (Pseudomonas syringae pv. syringae B728a)
MSNVSALPVQSGTTQSGGGSVRDRVSPEEWDVRVKLAAAYRLAALKRWTDHIYTHFSARV
PGPDEHFLINAFGLLFDEITASNLVKVDIDGTIVDDPTGLGINYAGYVIHSAIHAARHDL
QAVLHTHTRDGIAVSAQKDGLLPISQHSIAFSGRVAYHGYEGIALDLSERERLVADLGDK
SVMILRNHGLLTGGVSVEHAFQQLHALEYACNIQIAAQSAGNAELVFPPREVIAKVEQQA
KAIKDGHAPGVARHWNALIRELERNDTDYRT