Protein Info for Psyr_2283 in Pseudomonas syringae pv. syringae B728a

Annotation: Secretion protein HlyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 41 to 373 (333 residues), 277.5 bits, see alignment E=6.1e-87 PF16576: HlyD_D23" amino acids 65 to 292 (228 residues), 48 bits, see alignment E=2e-16 PF13533: Biotin_lipoyl_2" amino acids 66 to 114 (49 residues), 31.5 bits, see alignment 2.5e-11 PF00529: CusB_dom_1" amino acids 171 to 360 (190 residues), 28 bits, see alignment E=3.3e-10 PF13437: HlyD_3" amino acids 176 to 289 (114 residues), 30.9 bits, see alignment E=7.5e-11

Best Hits

Swiss-Prot: 46% identical to ACRA_ECOLI: Multidrug efflux pump subunit AcrA (acrA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2283)

MetaCyc: 46% identical to multidrug efflux pump membrane fusion lipoprotein AcrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-1551; TRANS-RXN-1552; TRANS-RXN-354; TRANS-RXN-355; TRANS-RXN-356; TRANS-RXN-357; TRANS-RXN-359; TRANS-RXN-360; TRANS-RXN0-592

Predicted SEED Role

"RND efflux system, membrane fusion protein CmeA" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU46 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Psyr_2283 Secretion protein HlyD (Pseudomonas syringae pv. syringae B728a)
MSSFSDWRVMPAVALLAALGLSGCEQKQQQDHAASTAPKEVEAITVNTESFTVVDELPGR
IEPVRVAQVRARVAGIVLSRNFEEGADVKAGAVLFQIDPAPFKAALSKAQGDLARTQATL
FETQATVKRYESLVEIEAVSRQTFDTARSALQNAVAAKRSAEADVETARLNLGYATVKAP
ISGRIGRAMVTEGALVGQGETTLLATIQQLDPVYADFTQPAAEALQMRAAIQEGRLPKGG
EDALSLSVDGTDYTSTGTLLFTDVAVDRTTGQVSLRARFANPKGVLLPGMYVRVRTPQRV
DSNAILVPQRAVQRSGDGAARVLVIAQDGTVEARPVKTGAMQDSRWQITEGLKAGEQVIV
GNMTGLSAGDKVARKSPSAQPQAKAQ