Protein Info for Psyr_2275 in Pseudomonas syringae pv. syringae B728a

Annotation: glutamate synthase (NADPH) GltB3 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01493: GXGXG
  • amino acids 43 to 189 (147 residues), 40.3 bits, E=1.3e-14

Best Hits

Swiss-Prot: 59% identical to GLXC_RHIME: Protein GlxC (glxC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 98% identity to pst:PSPTO_2584)

MetaCyc: 56% identical to N-methyl-L-glutamate synthase beta subunit (Methyloversatilis universalis)
Methylamine--glutamate N-methyltransferase. [EC: 2.1.1.21]

Predicted SEED Role

"Glutamate synthase [NADPH] putative GlxC chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• methylamine degradation II (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of trimethylamine degradation (3/6 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Methane metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13 or 2.1.1.21

Sequence Analysis Tools

See Q4ZU54 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Psyr_2275 glutamate synthase (NADPH) GltB3 subunit (Pseudomonas syringae pv. syringae B728a)
MKTVDLSSATVRDLNQALHDQVKELQDREWLVTHPDGAHNLAVGVNEAISIDIQGHAGYY
CAGMNQKASITVHGNVGVGCAENMMSGAVRVKGSASQAAGATAHGGLLVIEGDAGARCGI
SMKGIDIVVGGSIGHMSCFMGQAGRLVVCGDAGDALGDSLYETRIYVKGKVESLGSDCIA
KEMREEHLQELQELLNRAGFNEKAADFKRYGSARQLYNFKVDNASAY