Protein Info for Psyr_2274 in Pseudomonas syringae pv. syringae B728a

Annotation: glutamate synthase (NADPH) GltB1 subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13522: GATase_6
  • amino acids 139 to 270 (132 residues), 69.4 bits, E=3.1e-23
• PF13537: GATase_7
  • amino acids 148 to 275 (128 residues), 67.2 bits, E=1.3e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2274)

Predicted SEED Role

"Glutamine amidotransferase protein GlxB (EC 2.4.2.-)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 2.4.2.-)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.-

Use Curated BLAST to search for 2.4.2.-

Sequence Analysis Tools

See Q4ZU55 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Psyr_2274 glutamate synthase (NADPH) GltB1 subunit (Pseudomonas syringae pv. syringae B728a)
MCGIVGLYLKNPALESQLGKLFEPMLEAMTDRGPDSAGFAIYGDEVAQGWVKLTLQATSE
QYDFTALIAALQDRLSAQLDWFQNASAVVLKIQAEEAPVRAALAELAPTVRIMSAGQSIE
ILKGMGLPREISERFGLASMKGSHIIGHTRMATESAVTMEGSHPFSTGSDLCLVHNGSLS
NHFRLRQNLRREGIHFETDNDTEVAAGYLAWRLQQGDSLKQALDKSLEDLDGFFTFAIGT
RNGFAVIRDPIACKPAILAETDDYVAMASEYQALSSLPGIENARVWEPVPATMYIWEREP
AEGARP