Protein Info for Psyr_2271 in Pseudomonas syringae pv. syringae B728a

Annotation: membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 123 to 143 (21 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 202 to 220 (19 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 278 to 297 (20 residues), see Phobius details amino acids 317 to 340 (24 residues), see Phobius details amino acids 352 to 373 (22 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 14 to 222 (209 residues), 60 bits, see alignment E=1.3e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2271)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU58 at UniProt or InterPro

Protein Sequence (388 amino acids)

>Psyr_2271 membrane protein, putative (Pseudomonas syringae pv. syringae B728a)
MTTAVHPPRAPASRLRSIDALRGLIILFMLLDHVRETFFLHRQVLDPMDITATEPELFFS
RTLAHLCAPLFVLLTGLSAYLYGEKYQGRSDVSAFLLKRGLFLIALEFTLVSFAWTFEFP
PTVIYLQVIWAIGLSMVALSLMVFLPRWALVVIGVVIIAGHNLLDTLHFGVESAMHIPWA
ILHDRGWIEVSDNLRFRTSYPLLPWIGIIALGYAAGPWFVSGFDAATRQAKLWTWGLGAL
AGFVILRMINGYGEKPWSVGETGLQTVMSFFNITKYPPSLLFISLTLGIGMLILIGFERS
QEKSWLRPLVVLGSAPMFFYLLHLYVLKILYLIALAIWGANQGKYFGFDHMWGVWLTSVV
LAVLLFPAVRWFAALKARRRDISWLKYF