Protein Info for Psyr_2270 in Pseudomonas syringae pv. syringae B728a

Annotation: transferase hexapeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00132: Hexapep
  • amino acids 11 to 44 (34 residues), 28.4 bits, 4.7e-11
  • amino acids 79 to 111 (33 residues), 29.5 bits, 2.2e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2270)

Predicted SEED Role

"Carbonic anhydrase, gamma class (EC 4.2.1.1)" (EC 4.2.1.1)

MetaCyc Pathways

• cyanate degradation (3/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (8/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (9/14 steps found)
• 3-hydroxypropanoate cycle (7/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (9/18 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.1

Use Curated BLAST to search for 4.2.1.1

Sequence Analysis Tools

See Q4ZU59 at UniProt or InterPro

Protein Sequence (186 amino acids)

>Psyr_2270 transferase hexapeptide repeat protein (Pseudomonas syringae pv. syringae B728a)
MIRKNPSGHLPVIAESAYIDKTAIICGKVIIKDNVFVGPYAVIRADEVDATGDMEPIVIG
ANSNIQDGVVIHSKSGAAVTIGEFTSIAHRSIVHGPCIVGDRVFIGFNSVLFNCQVGKGS
VVRHNSVVDGRDLPEHFYVPSTTRIGSGTDLSQFPPVSISASEFSEDVARTNIDLVRGYK
ALQNEF