Protein Info for Psyr_2266 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 96 to 120 (25 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details amino acids 272 to 298 (27 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 1 to 100 (100 residues), 46.3 bits, see alignment E=4.7e-16 PF00528: BPD_transp_1" amino acids 112 to 303 (192 residues), 156.2 bits, see alignment E=7.9e-50

Best Hits

Swiss-Prot: 42% identical to GSIC_ECOL6: Glutathione transport system permease protein GsiC (gsiC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to pst:PSPTO_2575)

MetaCyc: 42% identical to glutathione ABC transporter membrane subunit GsiC (Escherichia coli K-12 substr. MG1655)
RXN0-11 [EC: 7.4.2.10]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU63 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psyr_2266 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MFGFLLRRLGIALCVAITVSVISFSLLHLSGDLATAIGGPEASSEQIEQIRVQYGLNKPL
VTQYFEWLADVVRLDLGDSFFFQESVYNLIASRLSITLGLGAMALSIALLIAIPLGVLAA
VKRDTWIDRLALSIAVLGQAMPSFWFALMLIVVFSVTLKWLPVSGNSTWAHFVMPAIALG
YYATPAIMRLTRAGMLDVLNSDYIRTARAKGLRPATVLFKHALRNALIPVVALAAVEFGF
MLGGSVVIETVFSLQGIGQLAWDAIARDDFPVVQAVVLLIAVIYIVLTLLADVLNALLDP
RIRVK