Protein Info for Psyr_2265 in Pseudomonas syringae pv. syringae B728a

Annotation: Binding-protein-dependent transport systems inner membrane component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 33 to 55 (23 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 216 to 243 (28 residues), see Phobius details amino acids 265 to 288 (24 residues), see Phobius details PF12911: OppC_N" amino acids 20 to 71 (52 residues), 45 bits, see alignment 7.7e-16 PF00528: BPD_transp_1" amino acids 118 to 296 (179 residues), 78 bits, see alignment E=8.1e-26

Best Hits

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 100% identity to psb:Psyr_2265)

MetaCyc: 35% identical to putrescine ABC exporter membrane protein SapC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-328 [EC: 7.6.2.16]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU64 at UniProt or InterPro

Protein Sequence (302 amino acids)

>Psyr_2265 Binding-protein-dependent transport systems inner membrane component (Pseudomonas syringae pv. syringae B728a)
MSTTTSSPLLINDYQPPARSVWRTLRSSFAHRGFAIGAVLLLIILLGALFAPWLAPYDPY
AQDVMLRMKPPVWMANGTWDYVLGTDKLGRDYLSRLLYGARISLFIGFSAALISGIIGTI
MGLLAGYFGGKTDALISYLITTRLAMPVVMIALASASLIGGSLKVVIVLLGCLLWDRFAV
VVRAAVQQIRDAEYVASAQALGCSTLRILASEILPNLVGALIVVATLEMAHAILLESALS
FLGVGVQPPIPSWGLMIAEGKPYMFFSPWVIAIPGVALMVLVLGINLVGDGLRDLILHDG
RN