Protein Info for Psyr_2264 in Pseudomonas syringae pv. syringae B728a

Annotation: Oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF00005: ABC_tran" amino acids 24 to 182 (159 residues), 96.7 bits, see alignment E=2.8e-31 PF13304: AAA_21" amino acids 132 to 218 (87 residues), 30.6 bits, see alignment E=5.4e-11 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 231 to 316 (86 residues), 76.2 bits, see alignment E=8.2e-26 PF08352: oligo_HPY" amino acids 233 to 299 (67 residues), 64.7 bits, see alignment E=1.2e-21

Best Hits

Swiss-Prot: 46% identical to OPPD_ECOLI: Oligopeptide transport ATP-binding protein OppD (oppD) from Escherichia coli (strain K12)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to psb:Psyr_2264)

MetaCyc: 46% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"peptide ABC transporter, ATP-binding protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZU65 at UniProt or InterPro

Protein Sequence (333 amino acids)

>Psyr_2264 Oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal (Pseudomonas syringae pv. syringae B728a)
MALLHVENLRVEIPLGQDTLHAVRGLDFQVERGEMLCIVGESGCGKSLTSLALMDLLPRK
ARRTATTLSLDGIDMLTQSERQMCDLRGNRLAMIFQEPMTSLNPAYSIGDQLSEVLTRHR
KVSRKEALQRAAQMLEKVGISNAGERLRQYPHQLSGGLRQRVIIAMALMCEPDVIIADEP
TTALDVTIQAQILRLIRDIQKELGLAVIFITHDLGLVARIADRVAVMYAGQIVETAPAIE
LFENPQHPYTRGLLASIPIPGRTQPGQPLGSIPGLVPSLVGEQHGCAFRNRCPQAIPACA
DDVPPINSHNHMTRCLFAAAGAEPVFHREGAPS