Protein Info for Psyr_2214 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 710 TIGR00229: PAS domain S-box protein" amino acids 24 to 138 (115 residues), 61.6 bits, see alignment E=4.1e-21 amino acids 146 to 257 (112 residues), 59.4 bits, see alignment E=1.9e-20 amino acids 269 to 381 (113 residues), 64.4 bits, see alignment E=5.7e-22 amino acids 393 to 506 (114 residues), 47.1 bits, see alignment E=1.2e-16 PF08448: PAS_4" amino acids 30 to 135 (106 residues), 45.4 bits, see alignment E=2.5e-15 amino acids 151 to 257 (107 residues), 42.2 bits, see alignment E=2.5e-14 amino acids 273 to 379 (107 residues), 44.7 bits, see alignment E=4.3e-15 amino acids 396 to 501 (106 residues), 24.5 bits, see alignment E=8.1e-09 PF00989: PAS" amino acids 31 to 129 (99 residues), 27.2 bits, see alignment E=1e-09 amino acids 153 to 253 (101 residues), 32 bits, see alignment E=3.2e-11 amino acids 275 to 369 (95 residues), 28.6 bits, see alignment E=3.7e-10 PF13426: PAS_9" amino acids 33 to 133 (101 residues), 41.7 bits, see alignment E=3.7e-14 amino acids 153 to 255 (103 residues), 45.6 bits, see alignment E=2.2e-15 amino acids 280 to 376 (97 residues), 39.1 bits, see alignment E=2.4e-13 amino acids 402 to 498 (97 residues), 29 bits, see alignment E=3.4e-10 PF08447: PAS_3" amino acids 42 to 127 (86 residues), 53.3 bits, see alignment E=8.5e-18 amino acids 164 to 249 (86 residues), 62.7 bits, see alignment E=9.4e-21 amino acids 286 to 371 (86 residues), 57.3 bits, see alignment E=4.5e-19 amino acids 407 to 493 (87 residues), 46.4 bits, see alignment E=1.2e-15 PF00015: MCPsignal" amino acids 536 to 689 (154 residues), 144.2 bits, see alignment E=1.1e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to psb:Psyr_2214)

Predicted SEED Role

"FOG: PAS/PAC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUB5 at UniProt or InterPro

Protein Sequence (710 amino acids)

>Psyr_2214 PAS (Pseudomonas syringae pv. syringae B728a)
MSTTIESTHRDKAGLELDLHSLMTAIDRSQAMIEFDLDGNILRANTNFLDCVGYRLDEVQ
GRHHRMFCTPEHASSVEYVTFWEKLGKGAFDEGQYKRLGKNGREIWLQATYNPVFDEQGN
PFKVVKFATDVTAQRKSNAEYEGKVAAIDRSQGIIEFDLNGRVLNANENFLKVLGYRLDE
IQGQHHRMFCEDDYLNSPAYRAFWAKLERGEYDSGEYKRIGKNGRELWISATYNPIFDPD
GRPYKVVKFANDVTESRIRQAESAGKVTAIERSQAVIEFDLTGKVLHANRNFLAVFGYDL
DEIVGEHHRMFCSEEFVSSLQYRELWEKLGRGEYDANEYKRKRKDGKEIWIQATYNPIFD
AQGKPYKIVKFALDVTVAKETSVEDQGKVNAIDRAQAVIEFDMAGNIITANANFLKALGY
GLLEIKGKHHRIFCEEEYVRGTEYREFWHGLGQGEFYSGRFMRVSKYGQKIWIQATYSPI
FDHDGLPFKVVKFATDITRQVEMEQAIEAKTRAMGESVKALMNAISYVAQSTETATDLAR
MTREQARSGSQTLVKASDAMGMIAKSAEGIQDIIQVISEIASQTNMLAFNAAIEAARAGE
HGLGFSVVADEVRKLAEKSSRATKEINKLILETVSRIESGNEISRSAGEAFEHIVEGVMQ
TTQAIDGINTATEKQRLSAQEVETLIVELHKANLTGYTETLNKVSIGQPA