Protein Info for Psyr_2210 in Pseudomonas syringae pv. syringae B728a

Annotation: D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 PF02826: 2-Hacid_dh_C" amino acids 113 to 282 (170 residues), 161.3 bits, see alignment E=7.9e-52

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2210)

Predicted SEED Role

"D-isomer specific 2-hydroxyacid dehydrogenase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUB9 at UniProt or InterPro

Protein Sequence (319 amino acids)

>Psyr_2210 D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding protein (Pseudomonas syringae pv. syringae B728a)
MTRLVIASQLDNDFNQVIRERLAVTHPEARVIGVPAGVPSDLPAEVSILLARPINVHGYE
APASPPPGWPYGLKWIQVVSSGIDFYPGWLFDGPPVSTSRGSAAENIAEFSLAAIFAAAK
HLPDIWVHDSQWNFTALTPLKGTTLGILGFGAIGSSLAGKALALGINVVALRQSQTPFEV
DGVESTRDIHELFSRADHLVLAAPLTPATRHIVNADVLNSAKPGLHLINIARGGLLDHEA
LLNALDQGNIGLASLDVTEPEPLPDGHPLYAHPRVRLSPHTSAISSNSRHEIADSFLANL
DRFLSGQALQNQADHQRGY