Protein Info for Psyr_2203 in Pseudomonas syringae pv. syringae B728a

Annotation: amino acid/amide ABC transporter membrane protein 2, HAAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 265 to 290 (26 residues), see Phobius details amino acids 297 to 305 (9 residues), see Phobius details amino acids 310 to 339 (30 residues), see Phobius details amino acids 346 to 370 (25 residues), see Phobius details TIGR03408: urea ABC transporter, permease protein UrtC" amino acids 47 to 369 (323 residues), 394.2 bits, see alignment E=3.1e-122 PF02653: BPD_transp_2" amino acids 57 to 359 (303 residues), 99.1 bits, see alignment E=1.2e-32

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 100% identity to psb:Psyr_2203)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtC" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUC6 at UniProt or InterPro

Protein Sequence (380 amino acids)

>Psyr_2203 amino acid/amide ABC transporter membrane protein 2, HAAT family (Pseudomonas syringae pv. syringae B728a)
MNDMTEKPTLRPQASVSGAGKPAGGWLTLIERYSLIWLSLLLLVALPLILGDFRLGLAGK
YLSLAFCAVGMVMIWGYGGILSLGQGIFFGLGSYMMAMYLKLEATATDEAASALAAFYGS
ALPDFMIWNSVEALPLWWKPFESATFTLAAILILPALLAFLFSYAYFKKRVGGVYFSIIT
LSLASIMSIMIIGQQGYTGGVNGLTDFKTAFGLSLQTPQTPWILYLITTLLLLASVAMCG
FILRSRLGKVIVAIRDREDRVRFSGYNTALFKAFIFAVAALISALGGVMFTLQVGLASPS
LVGIIPSTEIVIYAALGGRLSLVGAVYGTLLIGTAKTWLSENFVSFWQYFIGFLFMAVVL
FLPTGLAGLLQRLSNKETQS