Protein Info for Psyr_2196 in Pseudomonas syringae pv. syringae B728a

Annotation: Urease accessory protein UreG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03308: MeaB
  • amino acids 20 to 213 (194 residues), 39.2 bits, E=4.2e-14
• TIGR00101: urease accessory protein UreG
  • amino acids 22 to 216 (195 residues), 248.7 bits, E=2.2e-78
• PF02492: cobW
  • amino acids 23 to 194 (172 residues), 101.9 bits, E=3.3e-33

Best Hits

Swiss-Prot: 71% identical to UREG2_BRASB: Urease accessory protein UreG 2 (ureG2) from Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182)

KEGG orthology group: K03189, urease accessory protein (inferred from 100% identity to psb:Psyr_2196)

MetaCyc: 53% identical to urease accessory protein GTPase UreG (Helicobacter pylori 26695)

Predicted SEED Role

"Urease accessory protein UreG" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Sequence Analysis Tools

See Q4ZUD3 at UniProt or InterPro

Protein Sequence (220 amino acids)

>Psyr_2196 Urease accessory protein UreG (Pseudomonas syringae pv. syringae B728a)
MSLPLNASAPHTDAQPHPGAARVGIGGPVGSGKTRLLEQLILRFIARGTELAIITNDLAT
REDAERVQRSGLIDPQRVRAVETGACPHTAIREDPTLNLQMADELEARFGNLDLVLIESG
GDNLASTFSLDLVDYWIFVIDVAGGDDIPRKRGPGVLSCDLLVVNKYDLAPYVGVDLPRM
RRESAQARNGQPVLFTNCNTGEGVDAVVDAISRAVLFDRT