Protein Info for Psyr_2187 in Pseudomonas syringae pv. syringae B728a

Annotation: General substrate transporter:Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 89 to 118 (30 residues), see Phobius details amino acids 156 to 177 (22 residues), see Phobius details amino acids 183 to 201 (19 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details amino acids 337 to 359 (23 residues), see Phobius details amino acids 372 to 397 (26 residues), see Phobius details amino acids 404 to 427 (24 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 284 (257 residues), 93.6 bits, see alignment E=1.8e-30 amino acids 255 to 424 (170 residues), 72.4 bits, see alignment E=5.2e-24 PF00083: Sugar_tr" amino acids 51 to 422 (372 residues), 30.3 bits, see alignment E=3.1e-11 PF13347: MFS_2" amino acids 160 to 399 (240 residues), 36.1 bits, see alignment E=4.6e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2187)

Predicted SEED Role

"Major facilitator superfamily MFS_1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUE2 at UniProt or InterPro

Protein Sequence (440 amino acids)

>Psyr_2187 General substrate transporter:Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MPNNKNASLGKIHRFSWVSLLVCWMIWILNAYDREIVLRLGPTISKHFDLSADQWGTVAT
VVMLALAVLDIPGSIWSDRYGGGWKRARFQVPLVLGYTALSFLSGFKALSGSLASFIALR
VGVNLGAGWGEPVGVSNTAEWWPVERRGFALGAHHTGYPIGAMLSGIVASFVISTYGEEN
WRYVFFFAFVVALPLMIFWARYSTAERITQLYVDIAAKGMTPPDSTPSTNVKGQVWKSVK
ATLSNRNIALTAGNTLLTQVVYMGVNIVLPAYLYNILNLSLAESAGMSVVFTLTGILGQL
IWPSLSDIIGRRITLIICGIWMAVSVGAFYFANTILIVIAVQLLFGLVANAVWPIYYAVA
SDSAQPSATSTANGIITTAMFIGGGVAPVLMGTLISMGGGWTSLSGYTVCFFVMAGCALG
GAFLQLFSHRPELLTVQRSV