Protein Info for Psyr_2184 in Pseudomonas syringae pv. syringae B728a

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details PF08659: KR" amino acids 15 to 172 (158 residues), 36.4 bits, see alignment E=1.1e-12 PF00106: adh_short" amino acids 15 to 198 (184 residues), 155.6 bits, see alignment E=2.4e-49 PF01370: Epimerase" amino acids 15 to 250 (236 residues), 30 bits, see alignment E=7.2e-11 PF13561: adh_short_C2" amino acids 20 to 257 (238 residues), 187.4 bits, see alignment E=6.4e-59

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2184)

MetaCyc: 86% identical to 2-deoxy-D-ribonate dehydrogenase (Pseudomonas simiae)
1.1.1.M55 [EC: 1.1.1.M55]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUE5 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Psyr_2184 Short-chain dehydrogenase/reductase SDR (Pseudomonas syringae pv. syringae B728a)
MSVLNRLVPYAGLRVLISGGAAGIGEVLAAAYLEAGAKVHVCDVSEAAIAAFLDRHPGSV
ATHADVADPAQIEAVFRVQRARFDGLDVLINNAGIAGPTAGIDAISEEEWQRTIDINLTG
QYRFAHHAVPLLKASPNAHLIHIASVAGRLGYAWRTPYAATKWAIVGLMKSLASELGESD
IRVNALLPGIVEGPRMDGVIRARAQQMNVPEEEMREEYLKKISLKRMVTAEDVAAMALFL
CSPAARNVTGQAISVDGNVEYL