Protein Info for Psyr_2166 in Pseudomonas syringae pv. syringae B728a

Annotation: phenylalanyl-tRNA synthetase, alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF02912: Phe_tRNA-synt_N" amino acids 20 to 87 (68 residues), 94.3 bits, see alignment E=3.5e-31 TIGR00468: phenylalanine--tRNA ligase, alpha subunit" amino acids 38 to 337 (300 residues), 363.5 bits, see alignment E=5.2e-113 PF01409: tRNA-synt_2d" amino acids 92 to 337 (246 residues), 366.1 bits, see alignment E=8.9e-114

Best Hits

Swiss-Prot: 100% identical to SYFA_PSE14: Phenylalanine--tRNA ligase alpha subunit (pheS) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K01889, phenylalanyl-tRNA synthetase alpha chain [EC: 6.1.1.20] (inferred from 99% identity to pst:PSPTO_2382)

Predicted SEED Role

"Phenylalanyl-tRNA synthetase alpha chain (EC 6.1.1.20)" (EC 6.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.20

Use Curated BLAST to search for 6.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUG3 at UniProt or InterPro

Protein Sequence (338 amino acids)

>Psyr_2166 phenylalanyl-tRNA synthetase, alpha subunit (Pseudomonas syringae pv. syringae B728a)
MENLDALVSQALEAVQSAEDINALEQIRVHYLGKKGELTQVMKTLGNLPAEERPQVGALI
NVAKERVTEVLNARKASFEQAELTARLAAECIDVTLPGRGQTSGGLHPITRTLERIEQFF
THIGYGIAEGPEVEDDYHNFEALNIPGHHPARSMHDTFYFNANMLLRTHTSPVQVRTMES
QQPPIRIVCPGRVYRSDSDITHSPMFHQIEGLLVDRDINFADLKGTIEEFLRVFFEKELA
VRFRPSYFPFTEPSAEVDMECVMCSGKGCRVCKQTGWLEVMGCGMVHPNVLRMSGIDPEE
FQGFAFGMGVERLAMLRYGVNDLRLFFDNDLRFLAQFR