Protein Info for Psyr_2157 in Pseudomonas syringae pv. syringae B728a

Annotation: Inosine/uridine-preferring nucleoside hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01156: IU_nuc_hydro
  • amino acids 33 to 331 (299 residues), 315.8 bits, E=1.9e-98

Best Hits

Swiss-Prot: 41% identical to RIHA_KLEP7: Pyrimidine-specific ribonucleoside hydrolase RihA (rihA) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K01239, purine nucleosidase [EC: 3.2.2.1] (inferred from 100% identity to psb:Psyr_2157)

Predicted SEED Role

"Inosine-uridine preferring nucleoside hydrolase (EC 3.2.2.1)" in subsystem Purine conversions or Queuosine-Archaeosine Biosynthesis (EC 3.2.2.1)

MetaCyc Pathways

• purine nucleotides degradation I (plants) (10/12 steps found)
• adenosine nucleotides degradation I (7/8 steps found)
• guanosine nucleotides degradation II (4/4 steps found)
• superpathway of purines degradation in plants (14/18 steps found)
• superpathway of guanosine nucleotides degradation (plants) (5/6 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• guanosine nucleotides degradation I (3/4 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.2.2.1

Sequence Analysis Tools

See Q4ZUH2 at UniProt or InterPro

Protein Sequence (341 amino acids)

>Psyr_2157 Inosine/uridine-preferring nucleoside hydrolase (Pseudomonas syringae pv. syringae B728a)
MTLIQFSRQFIRGALLLSILGTAAVQAAEKRDLIIDTDPGADDVVALLLALASPEELNVM
AITTVAGNVRLDKTSRNARLAREWAGREEVPVYAGAPKPLVRTPIYAENVHGQEGLPGVP
VHEPAKGLAEGNAVDYLIRTLSKAKPHSITIAMLGPQTNLALALVQAPEITQGIKEVVVM
GGAHFNGGNITPVAEFNLFADPHAAQIVLASGVKLTYVPLDVTHKILTSEQRLKQIAALG
NNAGKLVDGILNEYVKLDMEHYGLPGGPVHDASVIAWLLKPELFSGRQINVTVDTREGIG
FGQTVADWYGTLKQPQNVFWVENGDAQGFFDLLTERLARLK