Protein Info for Psyr_2152 in Pseudomonas syringae pv. syringae B728a

Annotation: monosaccharide ABC transporter ATP-binding protein, CUT2 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00005: ABC_tran" amino acids 25 to 174 (150 residues), 113.1 bits, see alignment E=8.5e-37 amino acids 273 to 429 (157 residues), 72.3 bits, see alignment E=3.3e-24

Best Hits

Swiss-Prot: 45% identical to RBSA2_STRCO: Ribose import ATP-binding protein RbsA 2 (rbsA2) from Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 100% identity to psb:Psyr_2152)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUH7 at UniProt or InterPro

Protein Sequence (517 amino acids)

>Psyr_2152 monosaccharide ABC transporter ATP-binding protein, CUT2 family (Pseudomonas syringae pv. syringae B728a)
MSASAQTAVLSVSGIGKTYAQPVLGDVDLTLMRGEVLALTGENGAGKSTLSKIIGGLVTP
TTGNMEFQGQPYQPASRTQAEKLGIRMVMQELNLLPTLTVAENLFLHDLPRRAGWIDRKR
LRENATEAMAQVGLDAIDPDTLVGELGIGHQQMVEIARNLIGDCHVLILDEPTAMLTSRE
VEMLFEQITRLQARGVSIIYISHRLEELARVSQRIAVLRDGKLVCVEPIARYNSEQLVTL
MVGRELGEHIDMGARQIGEVALSVKGLSRAGKVQDVSFDVRRGEIFGISGLIGAGRTELL
RLIYGADVADSGDIEVGSSLQKVSIRSPADAVAQGIALITEDRKSEGLLMSQSISANIAL
GNMHSISSAGVVNSEDELKLAQRQVAAMRIRSSSPGQLVSELSGGNQQKVVIGRWLERDC
TVMLFDEPTRGIDIGAKFDIYALLAELTRQGRALVMVSSDLRELMLICDRIGVLSAGRLI
DTFERDSWTQDQLLAAAFAGYQKRDALLNDAAPRNNS