Protein Info for Psyr_2138 in Pseudomonas syringae pv. syringae B728a

Annotation: Glycosyl transferase, family 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13641: Glyco_tranf_2_3
  • amino acids 5 to 223 (219 residues), 54.4 bits, E=2.5e-18
• PF00535: Glycos_transf_2
  • amino acids 9 to 173 (165 residues), 54.1 bits, E=2.9e-18
• PF13506: Glyco_transf_21
  • amino acids 96 to 223 (128 residues), 23 bits, E=7.8e-09

Best Hits

Swiss-Prot: 51% identical to RFBN_SALTY: O antigen biosynthesis rhamnosyltransferase RfbN (rfbN) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K12992, rhamnosyltransferase [EC: 2.4.1.-] (inferred from 100% identity to psb:Psyr_2138)

MetaCyc: 51% identical to dTDP-Rha:alpha-D-Gal-diphosphoundecaprenol alpha-1,3-rhamnosyltransferase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN-21844 [EC: 2.4.1.377]

Predicted SEED Role

"O antigen biosynthesis rhamnosyltransferase rfbN (EC 2.4.1.-)" (EC 2.4.1.-)

MetaCyc Pathways

• Salmonella enterica serotype O:3,10 O antigen biosynthesis (2/5 steps found)
• Porphyromonas gingivalis O-LPS antigen biosynthesis (2/6 steps found)
• Salmonella enterica serotype O:2 O antigen biosynthesis (2/6 steps found)
• Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (2/6 steps found)
• Salmonella enterica serotype O:9 O antigen biosynthesis (2/6 steps found)
• Salmonella enterica serotype O:9,46 O antigen biosynthesis (2/6 steps found)
• Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (2/9 steps found)

KEGG Metabolic Maps

• Anthocyanin biosynthesis
• Carotenoid biosynthesis - General
• Flavone and flavonol biosynthesis
• Flavonoid biosynthesis
• Fructose and mannose metabolism
• Glycerolipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Glycosphingolipid biosynthesis - globo series
• Glycosphingolipid biosynthesis - lacto and neolacto series
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• High-mannose type N-glycan biosynthesis
• Keratan sulfate biosynthesis
• Lipopolysaccharide biosynthesis
• N-Glycan biosynthesis
• O-Glycan biosynthesis
• O-Mannosyl glycan biosynthesis
• Peptidoglycan biosynthesis
• Sphingolipid metabolism
• Zeatin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.- or 2.4.1.377

Sequence Analysis Tools

See Q4ZUJ1 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Psyr_2138 Glycosyl transferase, family 2 (Pseudomonas syringae pv. syringae B728a)
MAPLRVACVIPTYNGRKDLERLLDSLAAQTASFDTLIVDSSSSDGTLELAQARCANVLRI
DSKDFNHGGTRQMMVDLHPDYDVYVFMTQDAYVEDINAIANILLPFADPKVGAVCGRQLP
HKDANLLAQHARLFNYPPTSQIKTLADAGTLGIKTPFMSNSFAAYRGEALRAIGGFPRHV
ILSEDMYVTAKMLIDGWKAAYEGSAVCRHSHNYSLREEFRRYFDIGVFQAREAWIYETFG
GIGGEGMRYVKSELKFLGPRRILWWPVSFVRNALKLLAYKLSRQEKRLPRGVKKKLGMYA
RYWDSPYA