Protein Info for Psyr_2125 in Pseudomonas syringae pv. syringae B728a

Annotation: 3-carboxy-cis,cis-muconate cycloisomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02426: 3-carboxy-cis,cis-muconate cycloisomerase
  • amino acids 8 to 351 (344 residues), 461 bits, E=1.1e-142
• PF00206: Lyase_1
  • amino acids 15 to 303 (289 residues), 230.7 bits, E=2.9e-72
• PF10397: ADSL_C
  • amino acids 367 to 444 (78 residues), 73.6 bits, E=1.4e-24

Best Hits

Swiss-Prot: 76% identical to PCAB_PSEAE: 3-carboxy-cis,cis-muconate cycloisomerase (pcaB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01857, 3-carboxy-cis,cis-muconate cycloisomerase [EC: 5.5.1.2] (inferred from 100% identity to psb:Psyr_2125)

MetaCyc: 72% identical to subunit of 3-carboxymuconate cycloisomerase (Pseudomonas putida)
3-carboxy-cis,cis-muconate cycloisomerase. [EC: 5.5.1.2]

Predicted SEED Role

"3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2)" in subsystem Protocatechuate branch of beta-ketoadipate pathway (EC 5.5.1.2)

MetaCyc Pathways

• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• aromatic compounds degradation via β-ketoadipate (6/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
• superpathway of aerobic toluene degradation (9/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (10/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.5.1.2

Sequence Analysis Tools

See Q4ZUK4 at UniProt or InterPro

Protein Sequence (453 amino acids)

>Psyr_2125 3-carboxy-cis,cis-muconate cycloisomerase (Pseudomonas syringae pv. syringae B728a)
MNRASNQLFDAYFMQPEMREIFSDEGRVQGMLDFEAALARAQARVGLIPPEVVADIELSC
DARLFDFDALAIAIGSAGNSAIPLVKALGKQIAARSAEAERYVHMGATSQDVMDSGLILQ
LRRAIVLLEHDLTRLADAMAEQAQHHAGTPLAGRTWLQQATPVTLGMKIAGWLGAVTRHR
QRLNEIKPRLLCLQFGGASGSLAALGDQAFSVAEALAGELQLALPEQPWHTQRDRLVEFA
SLLGLIAGSLGKLGRDVSLLMQTEVGEVFEPSAPGKGGSSTMPHKRNPVGAAVMISTATR
APGLVATMLAAMPQEHERSLGLWHAEWETLPELCCLVSGSLQQALQVIPGLQVDAERMAV
NLQSTKGLILAEAVSIALAQRIGRDAAHHLVEQCCRRAVEQGAHLRQVLDETPQVSEQFS
SDELDRLLDPAHYLGQARHWVERAVAEHTRISR