Protein Info for Psyr_2121 in Pseudomonas syringae pv. syringae B728a

Annotation: regulatory protein, LysR:LysR, substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR02424: pca operon transcription factor PcaQ" amino acids 5 to 301 (297 residues), 421.3 bits, see alignment E=8.2e-131 PF00126: HTH_1" amino acids 9 to 67 (59 residues), 67 bits, see alignment E=1.1e-22 PF03466: LysR_substrate" amino acids 97 to 298 (202 residues), 116.5 bits, see alignment E=1.2e-37

Best Hits

Swiss-Prot: 38% identical to YDCI_ECOLI: Uncharacterized HTH-type transcriptional regulator YdcI (ydcI) from Escherichia coli (strain K12)

KEGG orthology group: K02623, LysR family transcriptional regulator, pca operon transcriptional activator (inferred from 100% identity to psb:Psyr_2121)

Predicted SEED Role

"LysR family transcriptional regulator YdcI" in subsystem DNA-binding regulatory proteins, strays

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUK8 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Psyr_2121 regulatory protein, LysR:LysR, substrate-binding protein (Pseudomonas syringae pv. syringae B728a)
MNIDTRIKFRHLVCFLEVARQGSLARASDVLAISQPALSKSLKELETLLDTTLFVRSKSG
AALTEAGVAFMRFAGPSVQALREGVSSLRSGEHDTVTARLGVLSTAESLLVPEVVHRLHQ
RHPALIVSVMTGPSAYLLSQLRVGELDLVVGRMTDSPQIQGLTFEHLYNESMTLVVRSDH
PLLAAPLKPESLEQFPLVLPLAGTTIRKFADSLFVQCGIRMPRQRLETLSLTLSRRYVQC
SDAVWIAPLDAVSLELKGGTLVELDMGIREPGGSVGLCSNPALPLTRAAQWCVDELRSLG
EACRKV