Protein Info for Psyr_2119 in Pseudomonas syringae pv. syringae B728a

Annotation: Acyltransferase 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 44 to 63 (20 residues), see Phobius details amino acids 84 to 105 (22 residues), see Phobius details amino acids 127 to 151 (25 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 332 (328 residues), 102 bits, see alignment E=1.8e-33

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2119)

Predicted SEED Role

"Exopolysaccharide production protein ExoZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUL0 at UniProt or InterPro

Protein Sequence (356 amino acids)

>Psyr_2119 Acyltransferase 3 (Pseudomonas syringae pv. syringae B728a)
MERLYSLQGLRGVAVLGVVLFHMMSVESKFSGGDILLPPWLDFFQLGVDLFFVISGFVMV
IVSRGRFQSAIEAQRFLFNRVSRIYPTYWLYFFITLAVYLVQPGMVNSGHGSSNLIMSFL
LLPNDKVLLVMVAWSLLFELWFYVVFSGFLLFRERSLPFLLGGWGVIIVVFNTLADWQDY
SSAVKIILHPYALEFMLGAALALFFYGRHSARVPTAAVWLLLGVALLAAVPLIGYYRLYE
SQGLLRMLMVGGSFGVLVLTLALLERRRHLLVPGFLVAVGDMSYTIYLSHLLVLGVIGRV
WSLVGAWPESYLDNLFFALLMLAATVCYGWVGYRYFEKPVLDRANAFSKAHFRVST