Protein Info for Psyr_2102 in Pseudomonas syringae pv. syringae B728a

Annotation: Nitrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 51 to 71 (21 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 162 (25 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 212 to 235 (24 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details amino acids 300 to 321 (22 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 366 to 385 (20 residues), see Phobius details PF07690: MFS_1" amino acids 23 to 349 (327 residues), 151.5 bits, see alignment E=2.9e-48 PF13347: MFS_2" amino acids 146 to 316 (171 residues), 30.7 bits, see alignment E=1.2e-11

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 100% identity to psb:Psyr_2102)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUM7 at UniProt or InterPro

Protein Sequence (403 amino acids)

>Psyr_2102 Nitrate transporter (Pseudomonas syringae pv. syringae B728a)
MDTSFWKAGHKPTLFAAFLYFDLSFMVWYLLGPLAVQIATDLQLTTQQRGLMVATPILAG
AVLRFFMGLLADQLSPKTAGIIGQVIVIGALLAAWQLGIHTYGQVLVLGVFLGMAGASFA
VALPLASQWYPAQHQGKAMGIAGAGNSGTVLAALIAPVLAASFGWSNVFGLALIPLVLTL
IAFTLMARNAPQRSKPKSMADYLKALGDRDSWWFMFFYSVTFGGFIGLASALPGYFNDQY
GLSPITAGYYTAACVFGGSLMRPLGGALADRFGGIRTLTVMYAVAAIGIAAVGFNLPSSW
AALALFVAAMLGLGAGNGAVFQLVPQRFRKEIGVMTGLIGMAGGIGGFLLAAGLGTIKQN
TGDYQLGLWLFAGLAVLAWFGLLNVKRRWRTTWGSAAVTAARV