Protein Info for Psyr_2075 in Pseudomonas syringae pv. syringae B728a

Annotation: 5-nucleotidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 PF06189: 5-nucleotidase" amino acids 2 to 298 (297 residues), 444.5 bits, see alignment E=7e-138

Best Hits

Swiss-Prot: 44% identical to 5NT1A_HUMAN: Cytosolic 5'-nucleotidase 1A (NT5C1A) from Homo sapiens

KEGG orthology group: K01081, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 100% identity to psb:Psyr_2075)

MetaCyc: 44% identical to cytosolic 5'-nucleotidase 1A subunit (Homo sapiens)
5'-nucleotidase. [EC: 3.1.3.5]

Predicted SEED Role

"5'-nucleotidase (EC 3.1.3.5)" in subsystem Purine conversions (EC 3.1.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUQ4 at UniProt or InterPro

Protein Sequence (306 amino acids)

>Psyr_2075 5-nucleotidase (Pseudomonas syringae pv. syringae B728a)
MTEAEDHKLVLAISSRALFDLRDSHEVYMADGVEAYRKYQIEHEDEILAQGDAFPLVEKL
LSLNASLEKARVEVVLVSRNSADTGLRVFNSIQHYGLDISRAAFAGGRSPYPYLAAFGCH
LFLSTHAEDVRSALDAGFAAATILSGGARRAASAELRIAFDGDAVLFSDESERVYQSGGL
AAFQASEREWAREPLRGGPFKPFLAALNQLQREFPDASCPIRTALVTARSAPAHERVIRT
LREWDIRLDESLFLGGLQKSAFLEAFAADVFFDDQPGHCEKARDVVATGHVPHGISNEIV
PLADGG