Protein Info for Psyr_2072 in Pseudomonas syringae pv. syringae B728a

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 117 PF14542: Acetyltransf_CG" amino acids 38 to 109 (72 residues), 79.8 bits, see alignment E=6.9e-27

Best Hits

Swiss-Prot: 34% identical to NATD1_XENTR: Protein NATD1 (natd1) from Xenopus tropicalis

KEGG orthology group: K06975, (no description) (inferred from 100% identity to psb:Psyr_2072)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUQ7 at UniProt or InterPro

Protein Sequence (117 amino acids)

>Psyr_2072 conserved hypothetical protein (Pseudomonas syringae pv. syringae B728a)
MFLRLKKTGKVGVKFQDPRGVAMSEALSIHHDEVGHHFEIIIDGHRAYLTYMDLGKQTLD
FYRTFVPDALRGRGIAAALTKEALDYADSMGYSVIPSCSYVERYMELHDLQSQAAKL