Protein Info for Psyr_2062 in Pseudomonas syringae pv. syringae B728a

Annotation: DoxD-like family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 88 to 109 (22 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details PF07681: DoxX" amino acids 16 to 103 (88 residues), 86.7 bits, see alignment E=1.3e-28

Best Hits

Swiss-Prot: 39% identical to MHQP_BACSU: Putative oxidoreductase MhqP (mhqP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_2062)

Predicted SEED Role

"Membrane protein, distant similarity to thiosulphate:quinone oxidoreductase DoxD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUR7 at UniProt or InterPro

Protein Sequence (144 amino acids)

>Psyr_2062 DoxD-like family protein (Pseudomonas syringae pv. syringae B728a)
MNTLIKSVLTTRAGYGLTVLRVIVGIAFIAHGSQKLFGAFGGYGLEGTAQYMESLGLTPG
YLMALMSGSAEFFGGLGLLLGLLARPAAVVVILLLLVAIFTVHIHNGFFMANNGYEYALA
LLGGAVAVLIEGAGKFSLDRIIGR