Protein Info for Psyr_2060 in Pseudomonas syringae pv. syringae B728a

Annotation: Sec-independent protein translocase TatD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01026: TatD_DNase
  • amino acids 4 to 262 (259 residues), 231.6 bits, E=5.1e-73

Best Hits

Swiss-Prot: 50% identical to TATD_RAHSY: 3'-5' ssDNA/RNA exonuclease TatD (tatD) from Rahnella sp. (strain Y9602)

KEGG orthology group: K03424, TatD DNase family protein [EC: 3.1.21.-] (inferred from 100% identity to psb:Psyr_2060)

MetaCyc: 44% identical to 3' -> 5' ssDNA/RNA exonuclease TatD (Escherichia coli K-12 substr. MG1655)
3.1.13.-; Exodeoxyribonuclease I. [EC: 3.1.11.1]

Predicted SEED Role

"Deoxyribonuclease TatD" in subsystem Twin-arginine translocation system or YcfH

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.1, 3.1.21.-

Use Curated BLAST to search for 3.1.11.1 or 3.1.21.-

Sequence Analysis Tools

See Q4ZUR9 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Psyr_2060 Sec-independent protein translocase TatD (Pseudomonas syringae pv. syringae B728a)
MQLIDIGVNLTNASFASQRQAVLDRAYAAGVEQLVVTGTSVEGSEHALQLCHELDESAQR
LFCTAGIHPHSASDWTGDTEKQLHALLKENRVRAVGECGLDYNRDFSPRPKQEKVLEAHL
AMAVELQLPVFLHERDANQRLLEILRDYRDRLPAAVVHCFTGERAALFSYLDLDLHIGIT
GWICDERRGTHLHALVGNIPRGRLMLESDAPYLLPRSLRPKPKNGRNEPAYLPEVLREVA
LHRGETQEDLARHSTDCARQFFALPTLKKSTED