Protein Info for Psyr_2048 in Pseudomonas syringae pv. syringae B728a

Annotation: Haloacid dehalogenase-like hydrolase:E1-E2 ATPase-associated region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 692 transmembrane" amino acids 53 to 72 (20 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 595 to 614 (20 residues), see Phobius details amino acids 625 to 645 (21 residues), see Phobius details amino acids 665 to 689 (25 residues), see Phobius details TIGR01497: K+-transporting ATPase, B subunit" amino acids 30 to 686 (657 residues), 965.1 bits, see alignment E=1.6e-294 TIGR01494: HAD ATPase, P-type, family IC" amino acids 87 to 355 (269 residues), 102.5 bits, see alignment E=1.9e-33 amino acids 381 to 612 (232 residues), 149.3 bits, see alignment E=1.2e-47 PF00122: E1-E2_ATPase" amino acids 123 to 220 (98 residues), 61.9 bits, see alignment E=9.1e-21 PF00702: Hydrolase" amino acids 315 to 540 (226 residues), 86 bits, see alignment E=9.5e-28 PF12710: HAD" amino acids 450 to 536 (87 residues), 30.1 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 84% identical to KDPB_PSEAE: Potassium-transporting ATPase ATP-binding subunit (kdpB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01547, K+-transporting ATPase ATPase B chain [EC: 3.6.3.12] (inferred from 100% identity to psb:Psyr_2048)

MetaCyc: 64% identical to K+ transporting P-type ATPase subunit KdpB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase B chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUT1 at UniProt or InterPro

Protein Sequence (692 amino acids)

>Psyr_2048 Haloacid dehalogenase-like hydrolase:E1-E2 ATPase-associated region (Pseudomonas syringae pv. syringae B728a)
MNLPINPAKNAAAKSTESQATESAKTGIAALWRPALVQAFVKLDPRQLKRSPVMLVVELT
AILTTVLCVIPNPQVPTSVCVQIALWLWFTVLFANFAEALAEGRGKARADSLKAGSEGLK
ARIRDDNGSLRIINASELRKGDVVRVEIGEMIPGDGEVIEGIAAVNEAAITGESAPVIRE
SGGDRSAVTGNTRLVSDWLLIRISANPGESTLDRMIALVEGAKRQKTPNEVALDILLIGL
TLIFLLVVITLQPFAHFAGGSLPLVFLVALLVTLIPTTIGGLLSAIGIAGMDRLVRLNVI
AKSGRAVEAAGDVHVLLLDKTGTITFGNRRCAAVYAAPGVTPKELGEGALLASLADDTAE
GKSIVEFLRNLHPMNEPALSSVTAVPFSADTRLSGVDYQGHVYRKGAVDSLLAFIDMQRS
ELPPVLAREVDKIAKTGGTPLLVCANGRLLGAIHLKDVVKPGIRERFEELRKLGIRTVMV
TGDNPLTAAAIAAEAGVDDVLAEATPEKKLERIRQEQGEGRLVAMCGDGANDAPALAQAD
VGMAMNDGTQAAREAANMVDLDSDPTKLLDVVQIGKELLVTRGALTTFSIANDVAKYFAV
LPALFASIYPQLGVLNVMKLTSPQSAIVSAIVFNALIIVVLIPLALRGVRVQAASAAHLL
RRNLLIYGLGGIVVPFIGIKLIDMLLVALGLV