Protein Info for Psyr_2032 in Pseudomonas syringae pv. syringae B728a

Annotation: two component transcriptional regulator, winged helix family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 PF00072: Response_reg" amino acids 33 to 141 (109 residues), 93.7 bits, see alignment E=8.6e-31 PF00486: Trans_reg_C" amino acids 180 to 253 (74 residues), 85.3 bits, see alignment E=2.5e-28

Best Hits

Swiss-Prot: 52% identical to VIRG_AGRT9: Regulatory protein VirG (virG) from Agrobacterium tumefaciens (strain 15955)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 100% identity to psb:Psyr_2032)

Predicted SEED Role

"DNA-binding response regulator GltR, controls specific porins for the entry of glucose"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUU7 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Psyr_2032 two component transcriptional regulator, winged helix family (Pseudomonas syringae pv. syringae B728a)
MAAQAGDRRIMQALPDTTLDAASTDQRWSVRALIVDDDVAIRELLCDYLTRFNINARGVT
DGTQMRQALTDETFDVVVLDLMLPGEDGLSLCRWLRSTSDIPILMLTARCEPTDRIIGLE
LGADDYMAKPFEPRELVARIQTILRRVRDERSDQRTTIRFDAWRLNSVLRQLTAADGLVV
PLSNAEFRLLRVFLERPHRVLSREQLLDAARGRSIEAFDRSIDLLVSRLRQKLGDDPKNP
QLIKTVRGEGYLFDARELG