Protein Info for Psyr_2010 in Pseudomonas syringae pv. syringae B728a

Annotation: 2-oxoglutarate dehydrogenase E2 component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 TIGR01347: dihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex" amino acids 3 to 410 (408 residues), 608.3 bits, see alignment E=3.9e-187 PF00364: Biotin_lipoyl" amino acids 4 to 75 (72 residues), 53 bits, see alignment E=3.7e-18 PF02817: E3_binding" amino acids 113 to 147 (35 residues), 59.5 bits, see alignment 4.6e-20 PF00198: 2-oxoacid_dh" amino acids 180 to 409 (230 residues), 290 bits, see alignment E=1.9e-90

Best Hits

Swiss-Prot: 77% identical to ODO2_PSEAE: Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (sucB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00658, 2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC: 2.3.1.61] (inferred from 100% identity to psb:Psyr_2010)

MetaCyc: 58% identical to 2-oxoglutarate dehydrogenase E2 subunit (Escherichia coli K-12 substr. MG1655)
Dihydrolipoyllysine-residue succinyltransferase. [EC: 1.2.1.105, 2.3.1.61]

Predicted SEED Role

"Dihydrolipoamide succinyltransferase component (E2) of 2-oxoglutarate dehydrogenase complex (EC 2.3.1.61)" in subsystem TCA Cycle (EC 2.3.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.105 or 2.3.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUW9 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Psyr_2010 2-oxoglutarate dehydrogenase E2 component (Pseudomonas syringae pv. syringae B728a)
MAIEIKAPSFPESVADGTISKWYKKEGDAVKRDEMLVDIETDKVVLEVLAEADGVMGTIT
KEEGAIVLSNEVLGTLNDGATASAAPAPAAAPAAAPASAPAAAPAATAGEEDPIAAPAAR
QLAEENGINLASVKGTGKDGRITKEDIVAAVEAKKSAPAAAPAAKPAAAAAPVVAAGDRT
EKRVPMTRVRATVAKRLVEAQSNMAMLTTFNEVDMTEVMALRSKYKDLFEKSHNGVRLGF
MSFFVKAATEALKRFPAVNASIDGSDIVYHGYADVGVAVSSDRGLVVPVLRNAEHMSLAE
IEGGIATFGKKARDGKLSIDEMTGGTFTITNGGTFGSMMSTPIVNPPQAAILGMHNILQR
PMAVNGQVVIRPMMYLALSYDHRLIDGKEAVTFLVTIKNLLEDPARLLLDI