Protein Info for Psyr_1994 in Pseudomonas syringae pv. syringae B728a

Annotation: Electron-transferring-flavoprotein dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 551 PF01946: Thi4" amino acids 4 to 57 (54 residues), 28.2 bits, see alignment 3.8e-10 PF00890: FAD_binding_2" amino acids 9 to 52 (44 residues), 20.9 bits, see alignment 6.4e-08 PF13450: NAD_binding_8" amino acids 12 to 57 (46 residues), 28.5 bits, see alignment 5.3e-10 PF21162: ETFQO_UQ-bd" amino acids 213 to 306 (94 residues), 146.1 bits, see alignment E=1.4e-46 PF05187: ETF_QO" amino acids 447 to 548 (102 residues), 168.9 bits, see alignment E=9.7e-54

Best Hits

Swiss-Prot: 87% identical to ETFD_PSEAE: Electron transfer flavoprotein-ubiquinone oxidoreductase (PA2953) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00311, electron-transferring-flavoprotein dehydrogenase [EC: 1.5.5.1] (inferred from 100% identity to psb:Psyr_1994)

Predicted SEED Role

"Electron transfer flavoprotein-ubiquinone oxidoreductase (EC 1.5.5.1)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases (EC 1.5.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.5.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZUY5 at UniProt or InterPro

Protein Sequence (551 amino acids)

>Psyr_1994 Electron-transferring-flavoprotein dehydrogenase (Pseudomonas syringae pv. syringae B728a)
MEREYMEFDVVIVGAGPSGLSAACRLKQKAAEAGQEISVCVVEKGSEVGAHILSGAVFEP
RALNELFPNWQELGAPLNTPVKRDDIYMLRDAEKAQKIPDFFVPKTMHNHGNYIISLGNL
CRWLAQQAENLGVEIYPGFAAQEALFDENGVVRGIVTGDLGVDREGNPKEGLYTPGMELR
AKYTLFAEGCRGHIGKQLLKRFNLDDEADVQHYAIGLKEIWEVDPAKHEQGLVVHTAGWP
LNDDNPGGSFLYHLENNQVVVGLIVDLSYSNPYLSPFDEFQRYKHHPVIKQYLEGGKRIS
YGARAITKGGLNSLPKMVFPGGALIGCDLGTLNFAKIKGSHTAMKSGMLAADSVADALLA
GKEGGDVLTSYVDAFKASWLHEELFASRNFGVAIHKYGAIKGGAFNFIDQNIFGGKLPFT
LHDTKPDYACLKLAADSKKIDYPKPDGKLSFDKLSSVFLSSTNHEEEQPCHLKLTDPSIP
ISKNLPLYDEPAQRYCPAGVYEVITKEDGEKRFQINAQNCVHCKTCDIKDPSQNITWVAP
EGAGGPTYPNM