Protein Info for Psyr_1974 in Pseudomonas syringae pv. syringae B728a

Annotation: Excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 671 TIGR00631: excinuclease ABC subunit B" amino acids 3 to 665 (663 residues), 1087.9 bits, see alignment E=0 PF04851: ResIII" amino acids 11 to 86 (76 residues), 41.4 bits, see alignment E=4.5e-14 PF17757: UvrB_inter" amino acids 159 to 248 (90 residues), 112.3 bits, see alignment E=2.8e-36 PF00271: Helicase_C" amino acids 433 to 543 (111 residues), 68.7 bits, see alignment E=1.5e-22 PF12344: UvrB" amino acids 550 to 591 (42 residues), 74.1 bits, see alignment 1.8e-24 PF02151: UVR" amino acids 633 to 666 (34 residues), 33.2 bits, see alignment (E = 9.3e-12)

Best Hits

Swiss-Prot: 100% identical to UVRB_PSEU2: UvrABC system protein B (uvrB) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 100% identity to psb:Psyr_1974)

MetaCyc: 74% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV05 at UniProt or InterPro

Protein Sequence (671 amino acids)

>Psyr_1974 Excinuclease ABC subunit B (Pseudomonas syringae pv. syringae B728a)
MSEFQLVTRFEPAGDQPEAIRQLVEGIDAGLAHQTLLGVTGSGKTFSIANVISQIKRPTL
VLAPNKTLAAQLYGEFKAFFPNNAVEYFVSYYDYYQPEAYVPSSDTFIEKDASINDHIEQ
MRLSATKALLERKDAIIVTTVSCIYGLGSPETYLRMVMHIDRGDKLDQRALLRRLADLQY
TRNDMDFARATFRVRGDVIDIYPAESDLEAIRVELFDDEVESLSAFDPLTGEVIRKLPRF
TFYPKSHYVTPRETLIEAMENIKVELQERLEYLRSQNKLVEAQRLEQRTRFDLEMMLELG
YCNGIENYSRYLSGRPSGAPPPTLFDYLPPDALLVIDESHVSVPQVGAMYKGDRSRKETL
VEYGFRLPSALDNRPMRFDEWEAISPQTIFVSATPGNYEAEHAGRIVEQVVRPTGLVDPQ
IEIRPALTQVDDLLSEIHKRAALEERVLVTTLTKRMSEDLTDYLSDHGVRVRYLHSDIDT
VERVEIIRDLRLGTFDVLVGINLLREGLDMPEVSLVAILDADKEGFLRSDRSLIQTIGRA
ARNLNGRAILYADRITGSMERAIGETERRREKQIAFNLEHGITPKGVFKDVADIMEGATV
PGSRSKKRKGMAKAAEENARYENELRSPSEINKRIRQLEEKMYQLARDLEFEAAAQMRDE
IGKLRERLLAV