Protein Info for Psyr_1968 in Pseudomonas syringae pv. syringae B728a

Annotation: RND efflux system, outer membrane lipoprotein, NodT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 462 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 7 to 457 (451 residues), 325.2 bits, see alignment E=3.5e-101 PF02321: OEP" amino acids 58 to 250 (193 residues), 64.3 bits, see alignment E=6.5e-22 amino acids 278 to 456 (179 residues), 82.9 bits, see alignment E=1.3e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1968)

Predicted SEED Role

"Outer membrane pyoverdine eflux protein" in subsystem Siderophore Pyoverdine

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV11 at UniProt or InterPro

Protein Sequence (462 amino acids)

>Psyr_1968 RND efflux system, outer membrane lipoprotein, NodT (Pseudomonas syringae pv. syringae B728a)
MKPSLSVLTACLLLSACQTPAPPPDSGIQPPASWAFAENAAAQRSDVRWWQQFGSPQLDR
LIEQASRDSHEVAAAMARVRQAQASAIIGGAPLLPELAFDLRGERNRFLRNSDRKANPSD
DNNTNNFTSDLTASYEVDFWGGIAAGRDSALQGLRASQFDQATVELTLLANVADRYAQTL
AAREQGRIAELNLANAQDVLRLVQTRYESGSATALELAQQKNLVATQQRELPRVQQLANE
QLITLAALLGQPVQNLHLADQPFDTLNWPDIGAGVPSELLTRRPDLAKAEADLAAAQANV
TVARAAMLPKLTLSARLGTENTRAEDWLRAPFSSLAAGLVGPIFNNGRLAAERDKATGRQ
EELLETYRGAIINSFADVEKALNSIGGLDQQRYWHEEELKQAQTAFRIAQSRYQEGAEDL
LTVLETQRTLYLAQDVSVQLRLARLQASIALYKALGGSWQVH