Protein Info for Psyr_1955 in Pseudomonas syringae pv. syringae B728a

Annotation: Propeptide, PepSY amd peptidase M4:PepSY-associated TM helix

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 197 to 220 (24 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details PF03929: PepSY_TM" amino acids 12 to 366 (355 residues), 212 bits, see alignment E=1.8e-66 PF03413: PepSY" amino acids 61 to 118 (58 residues), 29.3 bits, see alignment E=8.8e-11 amino acids 254 to 310 (57 residues), 19.3 bits, see alignment 1.1e-07

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1955)

Predicted SEED Role

"FIG137594: Putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV24 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Psyr_1955 Propeptide, PepSY amd peptidase M4:PepSY-associated TM helix (Pseudomonas syringae pv. syringae B728a)
MSKKSRSKIWFLVHSWLALPIWFFVLIVCVTGTLAVVSKEIMWLANPEMRDNRPSDDAQR
LNFEQIRATIERNQPDLIVGTIMQPDGDYFALSVFITYPDGRSVPAYVNPYTGVIQGITP
SFDFRRFTRALHGWWLVPFTNGYSWGWYLVSILGLPLLASLVTGLVVYKKFWRGFFKPVR
FSQGPRIFWGDLHRLSGVWSIWFIAVISITGTWFLIQAILGDNQISISSKSQVASIIPHS
AVPLTADGRPAPTISLERAVEIARERIPGLEASFITPPFNAYSNLQVGGRSWYPLMFQTA
EINPYSGEIAASHRLSDRNKLEFVTESMRPLHTGDFGGIWIKLIWAFFGLLLSMMVLSGL
LIWSKRTALATLNALKRETRARPATAAATPRNTSPSPLATRTPENSL