Protein Info for Psyr_1939 in Pseudomonas syringae pv. syringae B728a

Annotation: PAS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 779 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 187 to 209 (23 residues), see Phobius details PF05227: CHASE3" amino acids 47 to 178 (132 residues), 71.2 bits, see alignment E=3e-23 TIGR00229: PAS domain S-box protein" amino acids 265 to 389 (125 residues), 75.1 bits, see alignment E=2.7e-25 PF00989: PAS" amino acids 269 to 381 (113 residues), 40 bits, see alignment E=1.3e-13 PF13426: PAS_9" amino acids 282 to 383 (102 residues), 45.4 bits, see alignment E=2.9e-15 PF08448: PAS_4" amino acids 282 to 385 (104 residues), 25.4 bits, see alignment E=5.1e-09 PF00512: HisKA" amino acids 404 to 468 (65 residues), 69.8 bits, see alignment E=5.7e-23 PF02518: HATPase_c" amino acids 516 to 623 (108 residues), 97.8 bits, see alignment E=1.8e-31 PF00072: Response_reg" amino acids 660 to 768 (109 residues), 70.1 bits, see alignment E=6.4e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1939)

Predicted SEED Role

"Sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV40 at UniProt or InterPro

Protein Sequence (779 amino acids)

>Psyr_1939 PAS (Pseudomonas syringae pv. syringae B728a)
MTAHASSRWEGLPLRGKALVAISLPLAILMFSLVLIYIAERQTARAEEDVRRVLLVQGDI
QTLHTQIAEGAASVRGYLLTHQEDFLPGYLNAQPLIEAALARLNTNVRDEQMREHLKAIE
PLINTKVEGLEKLRSMNREDRETVARILIENKYVLDQLRERIGIMREREDALLAERTEAA
AATRERLLLSTLLAAACGIFGAILAVLMLSKGIVARVHQVQRNAQRLALGHPLLPQPPEK
DEIGQLGTRLVEAGQLLAERERALRDNEERLRLIIEGVKDYGIFALDRNGFITTWNAGAE
RIKGYTEQEIIGQHFSVFYLQQECPQHPDMALHEATVNGRYTEEGWRQRKDGSRFWASVV
ITAQYDSNDELRGFSKITRDISDRRVAEIALGTAREEAERASRAKSEFLSRMSHELRTPL
NSILGFAQLLDMDSPASQRPQIGHILRAGQHLLKLINEVLDIARIEAGHVSLILEPVSLS
NVLEEALVLVSPMAADANIELKPLPSLPDDIGVVADRQRLIQVLLNLLSNAIKYNRPAGQ
VRIEIEQIAEQVTISVVDTGYGIAPERIGQLFKPFERLDANPSVEGTGLGLALSKSMLEM
MHGTLSVQNTPDEGCRFILALPLVRVQPPAATLPRQADTRLEITPDARSPARPAYHGKLL
CIEDNLSSMALIETLLQRRPGIQLLSSMQGQLGLDLARQHAPQLILLDLNLPDIKGLEVL
QRLRQLPATAQTPVLMITADTSDKAHRELKQAGATAIVIKPIQVPVFLALLDQYLPEPT