Protein Info for Psyr_1936 in Pseudomonas syringae pv. syringae B728a

Annotation: tRNA-U16,U17-dihydrouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR00742: tRNA dihydrouridine synthase A" amino acids 21 to 335 (315 residues), 468.1 bits, see alignment E=8.2e-145 PF01207: Dus" amino acids 25 to 323 (299 residues), 291.3 bits, see alignment E=4.3e-91

Best Hits

Swiss-Prot: 93% identical to DUSA_PSESM: tRNA-dihydrouridine(20/20a) synthase (dusA) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K05539, tRNA-dihydrouridine synthase A [EC: 1.-.-.-] (inferred from 100% identity to psb:Psyr_1936)

MetaCyc: 60% identical to tRNA-dihydrouridine synthase A (Escherichia coli K-12 substr. MG1655)
1.1.1.-

Predicted SEED Role

"tRNA dihydrouridine synthase A"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV43 at UniProt or InterPro

Protein Sequence (339 amino acids)

>Psyr_1936 tRNA-U16,U17-dihydrouridine synthase (Pseudomonas syringae pv. syringae B728a)
MTPESLETPVNIGQPAPVLSRRFSVAPMMDWTDHHCRYFMRKLSKHALLYTEMVTTGALL
HGDRERFLRHDETEHPLALQLGGSTAADLAACSRLAQEAGYDEVNLNVGCPSDRVQNNMI
GACLMAHPELVADCVKAMRDAVGIPVTVKHRIGINGRDSYAELCDFVGKVQEAGCESFTV
HARIAILEGLSPKENRDIPPLRYDVVAQLKSDFPGLEIVLNGGIKTLEQCSEHLQTFDGV
MLGREAYHNPYLLAHVDQQLFGSTAPVISRYDALESMRPYIAAHIASGGNMHHVTRHMLG
LGLGFPGARRFRQLLSVDIHKAENPMLLLDQAAAFLQGH