Protein Info for Psyr_1916 in Pseudomonas syringae pv. syringae B728a

Annotation: Peptidase S24, S26A and S26B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF00717: Peptidase_S24" amino acids 24 to 129 (106 residues), 82.3 bits, see alignment E=1.1e-27

Best Hits

Swiss-Prot: 36% identical to UMUD_SALTY: Protein UmuD (umuD) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03503, DNA polymerase V [EC: 3.4.21.-] (inferred from 100% identity to psb:Psyr_1916)

Predicted SEED Role

"Error-prone repair protein UmuD"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.-

Use Curated BLAST to search for 3.4.21.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV62 at UniProt or InterPro

Protein Sequence (147 amino acids)

>Psyr_1916 Peptidase S24, S26A and S26B (Pseudomonas syringae pv. syringae B728a)
MSVTFLGPLSAGGIKLPFISLSSVGSRSPVVEKHVSIAELCEVREPHAYLARIEDQGMQG
SGMCSGDMLVVDRSQYAEHGDIVVASLNARQICRRLHMRGDVVILESQNPDYPPLHVTDN
DDLIILGVVTYSLKNLLEGRAASSAHR