Protein Info for Psyr_1905 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 TIGR02211: lipoprotein releasing system, ATP-binding protein" amino acids 11 to 230 (220 residues), 324.2 bits, see alignment E=1.8e-101 PF00005: ABC_tran" amino acids 31 to 179 (149 residues), 124 bits, see alignment E=6.7e-40

Best Hits

Swiss-Prot: 100% identical to LOLD_PSEU2: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to psb:Psyr_1905)

MetaCyc: 58% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV73 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Psyr_1905 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MSESGMSDKAVLSCRNLGKSYEEGPESVVVLSGLQLELHPGERVAIVGSSGSGKSTLLNL
LGGLDTPSEGSVWLAGEELSALGEKARGLLRNRALGFVYQFHHLLPEFTALENVCMPLLI
GRTPIPEARKRSTALLERVGLGHRLAHKPSELSGGERQRVAIARALINQPGLVMLDEPTG
NLDHHTAQGIQDLMRELSTSSRTAFLIVTHDMSLARQMDRVLRLEDGRLVEA