Protein Info for Psyr_1905 in Pseudomonas syringae pv. syringae B728a

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02211: lipoprotein releasing system, ATP-binding protein
  • amino acids 11 to 230 (220 residues), 324.2 bits, E=1.8e-101
• PF00005: ABC_tran
  • amino acids 32 to 179 (148 residues), 124.4 bits, E=5.5e-40

Best Hits

Swiss-Prot: 100% identical to LOLD_PSEU2: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09810, lipoprotein-releasing system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to psb:Psyr_1905)

MetaCyc: 58% identical to lipoprotein release complex - ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN-22427

Predicted SEED Role

"Lipoprotein releasing system ATP-binding protein LolD"

MetaCyc Pathways

• lipoprotein posttranslational modification (Gram-negative bacteria) (3/7 steps found)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

See Q4ZV73 at UniProt or InterPro

Protein Sequence (232 amino acids)

>Psyr_1905 ABC transporter (Pseudomonas syringae pv. syringae B728a)
MSESGMSDKAVLSCRNLGKSYEEGPESVVVLSGLQLELHPGERVAIVGSSGSGKSTLLNL
LGGLDTPSEGSVWLAGEELSALGEKARGLLRNRALGFVYQFHHLLPEFTALENVCMPLLI
GRTPIPEARKRSTALLERVGLGHRLAHKPSELSGGERQRVAIARALINQPGLVMLDEPTG
NLDHHTAQGIQDLMRELSTSSRTAFLIVTHDMSLARQMDRVLRLEDGRLVEA