Protein Info for Psyr_1898 in Pseudomonas syringae pv. syringae B728a

Annotation: Major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 420 transmembrane" amino acids 17 to 38 (22 residues), see Phobius details amino acids 58 to 80 (23 residues), see Phobius details amino acids 92 to 109 (18 residues), see Phobius details amino acids 119 to 140 (22 residues), see Phobius details amino acids 149 to 173 (25 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 228 to 247 (20 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 295 to 314 (20 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 357 to 379 (23 residues), see Phobius details amino acids 391 to 412 (22 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 366 (337 residues), 118.2 bits, see alignment E=2.1e-38

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1898)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZV80 at UniProt or InterPro

Protein Sequence (420 amino acids)

>Psyr_1898 Major facilitator superfamily (Pseudomonas syringae pv. syringae B728a)
MSSSALDGSQHPLKSSFFLLFLTIFIPFGLGHFVSYLFRTVNAVIYVDLQTDLSLPASSL
GLLTGVYFLTFAAAQIPLGVMLDRYGPRSVQAPMLLFAVAGSVIFSISSTETGLLIGRGL
IGLGVAGSLMSAIKACAIWLPVERLPLSTACLLSIGGLGAMASTTPLHALLSWLTWREAF
LVLALLTLCVAVVIHLSVPKAYESKKTRYSDMFAAVGKLYASWTFWRLALYSVFAHAIYM
SVLSLWMGPWLRDMAGLSDSAMANVLLFGAIAMVAGALTFGAITDYLRRFGVQPIMICGT
GMLIFIGFQVLMASGLPVSPYLIAMGFSFFGTSTTMNYAIVAQSVSPELAGRVSSSFNLV
VFVLAFFLQWLMGAVLNLWPAPQGAGHPLEAYQWSLGLMITLQLPGVLLWLSFRPWKRKV