Protein Info for Psyr_1860 in Pseudomonas syringae pv. syringae B728a

Annotation: Ankyrin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF12796: Ank_2" amino acids 27 to 113 (87 residues), 53 bits, see alignment E=1.1e-17 amino acids 78 to 149 (72 residues), 52.3 bits, see alignment E=1.8e-17 amino acids 118 to 173 (56 residues), 30.8 bits, see alignment E=8.9e-11 PF13637: Ank_4" amino acids 35 to 73 (39 residues), 24 bits, see alignment 9.5e-09 amino acids 60 to 102 (43 residues), 23.4 bits, see alignment 1.5e-08 amino acids 93 to 139 (47 residues), 37.7 bits, see alignment E=4.6e-13 amino acids 123 to 159 (37 residues), 25.9 bits, see alignment 2.5e-09 PF13857: Ank_5" amino acids 39 to 90 (52 residues), 31.3 bits, see alignment E=5.3e-11 PF13606: Ank_3" amino acids 53 to 80 (28 residues), 17.5 bits, see alignment 1.1e-06 amino acids 118 to 146 (29 residues), 29 bits, see alignment 1.9e-10 PF00023: Ank" amino acids 53 to 84 (32 residues), 26.4 bits, see alignment 1.5e-09 amino acids 85 to 113 (29 residues), 17.9 bits, see alignment 7.8e-07 amino acids 118 to 149 (32 residues), 34.1 bits, see alignment 5.2e-12

Best Hits

Swiss-Prot: 62% identical to Y3287_PSEAE: Putative ankyrin repeat protein PA3287 (PA3287) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K06867, (no description) (inferred from 100% identity to psb:Psyr_1860)

Predicted SEED Role

"FOG: Ankyrin repeat"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVB5 at UniProt or InterPro

Protein Sequence (181 amino acids)

>Psyr_1860 Ankyrin (Pseudomonas syringae pv. syringae B728a)
MTDTDISASKTMTEDEAAEFAEQVFDVARQGNAVMLERLLEKGLPADLRNHKGDTLLMLA
SYHCHADAVRVLLNHKADPEIRNDNGQSPIAGAAFKGDLAVVRLLVEAGADIDGASADGR
TALMMAAMFNRNEIVDYLISQGADPHATDAKGITALGAAQAMGATVTIEQLSKMGVQPAR
S