Protein Info for Psyr_1857 in Pseudomonas syringae pv. syringae B728a

Annotation: acireductone synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 PF00702: Hydrolase" amino acids 3 to 197 (195 residues), 50.7 bits, see alignment E=1.5e-17 TIGR01691: 2,3-diketo-5-methylthio-1-phosphopentane phosphatase" amino acids 3 to 219 (217 residues), 263.7 bits, see alignment E=1.2e-82 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 103 to 197 (95 residues), 24.4 bits, see alignment E=3.3e-09

Best Hits

Swiss-Prot: 100% identical to MTNC_PSEU2: Enolase-phosphatase E1 (mtnC) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K09880, enolase-phosphatase E1 [EC: 3.1.3.77] (inferred from 100% identity to psb:Psyr_1857)

Predicted SEED Role

"2,3-diketo-5-methylthiopentyl-1-phosphate enolase-phosphatase (EC 3.1.3.77)" in subsystem Methionine Salvage (EC 3.1.3.77)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVB8 at UniProt or InterPro

Protein Sequence (227 amino acids)

>Psyr_1857 acireductone synthase (Pseudomonas syringae pv. syringae B728a)
MPIKAILTDIEGTTSAVSFVFDVLFPFARKHLPAFVREHAEQPAVAQQLQAVRDLAGEPD
ADVERVIALLLEWIAEDRKATPLKALQGMVWEQGYNAGQLKGHVYPDAVDALKHWHQQGY
RLYVYSSGSIQAQQLIFGCSEAGDLSGLFSGYFDTTSGPKREAQSYRTIAQAMDCPAGDI
LFLSDIVEELDAAQAAGMATCGLARDGGALAGHRYVTSFALIDPASF