Protein Info for Psyr_1826 in Pseudomonas syringae pv. syringae B728a

Annotation: Conserved hypothetical protein 103

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 104 (102 residues), 111.3 bits, see alignment E=1.1e-36 PF02575: YbaB_DNA_bd" amino acids 10 to 98 (89 residues), 109.8 bits, see alignment E=3e-36

Best Hits

Swiss-Prot: 100% identical to Y1786_PSE14: Nucleoid-associated protein PSPPH_1786 (PSPPH_1786) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)

KEGG orthology group: K09747, hypothetical protein (inferred from 100% identity to psb:Psyr_1826)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVE9 at UniProt or InterPro

Protein Sequence (108 amino acids)

>Psyr_1826 Conserved hypothetical protein 103 (Pseudomonas syringae pv. syringae B728a)
MMKGGMAGLMKQAQQMQEKMAKMQEELANAEVTGQSGAGLVSVVMTGRHDVKRINLDDSL
MQEDKEVLEDLIAAAVNDAVRKIEQASQDKTASMTAGMQLPPGMKLPF