Protein Info for Psyr_1818 in Pseudomonas syringae pv. syringae B728a

Annotation: cell division protein ZipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details TIGR02205: cell division protein ZipA" amino acids 5 to 274 (270 residues), 261.3 bits, see alignment E=8.8e-82 PF04354: ZipA_C" amino acids 147 to 273 (127 residues), 160.1 bits, see alignment E=1.2e-51

Best Hits

Swiss-Prot: 100% identical to ZIPA_PSEU2: Cell division protein ZipA (zipA) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K03528, cell division protein ZipA (inferred from 100% identity to psb:Psyr_1818)

Predicted SEED Role

"Cell division protein ZipA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVF7 at UniProt or InterPro

Protein Sequence (287 amino acids)

>Psyr_1818 cell division protein ZipA (Pseudomonas syringae pv. syringae B728a)
MEIGLREWLIVIGIIVIAGILFDGWRRMRGSKGKLKFRLDRSFSNLPDEEETTSAEVLGP
PRVLDTHKEPQLDEHDLPSMSASPREGKRSNSDKRSDKKRKDEPQQGDLNLDLDGPSLFT
GRDDDFPDDKPTQRITEDKDLPPVEEVLVISVISRSEGGFKGPALLQNILESGLRFGEMD
IFHRHESMAGNGEVLFSMANAVKPGVFDLDDIDHFSTRAVSFFLGLPGPRHPKQAFDVMV
AAARKLAHELDGELKDDQRSVMTAQTIEHYRQRIVEFERRALTQRRG