Protein Info for Psyr_1807 in Pseudomonas syringae pv. syringae B728a

Annotation: Allantoicase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 TIGR02961: allantoicase" amino acids 11 to 328 (318 residues), 474.8 bits, see alignment E=5e-147 PF03561: Allantoicase" amino acids 20 to 165 (146 residues), 169.6 bits, see alignment E=2.1e-54 amino acids 187 to 329 (143 residues), 164.6 bits, see alignment E=7.2e-53

Best Hits

Swiss-Prot: 100% identical to ALLC_PSEU2: Probable allantoicase (alc) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K01477, allantoicase [EC: 3.5.3.4] (inferred from 100% identity to psb:Psyr_1807)

Predicted SEED Role

"Allantoicase (EC 3.5.3.4)" in subsystem Allantoin Utilization (EC 3.5.3.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVG8 at UniProt or InterPro

Protein Sequence (331 amino acids)

>Psyr_1807 Allantoicase (Pseudomonas syringae pv. syringae B728a)
MKVYAAPFEKFVNLADARLGTRILSVTDDWFADANRLFQPTPAVWKEGVFDDNGKWMDGW
ESRRKRFEGYDSAVIRLGVAGTIKGVDIDTSFFTGNFPPSASLEACFLASGEPDENTAWT
EVLPSVELQGNSHHYHEINNDQAFSHLRFNIYPDGGVARLRVYGVPHRDWSKVSADEQID
LVAALNGGRSIACSDEHYGSMSNILNPGRGVNMGDGWETARRRTPGNDWVIVALGHKGEV
EKVIVDTLHFKGNYPDSCSIQGALVKGGTDSQIETQSLFWRELLPSQKLTMHAEHEFAEQ
IKAIGPITHIRLNVFPDGGVSRLRVLGKVAR