Protein Info for Psyr_1802 in Pseudomonas syringae pv. syringae B728a

Annotation: transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 168 transmembrane" amino acids 67 to 88 (22 residues), see Phobius details PF13412: HTH_24" amino acids 19 to 66 (48 residues), 68.1 bits, see alignment E=5.8e-23 PF13404: HTH_AsnC-type" amino acids 19 to 60 (42 residues), 62.5 bits, see alignment E=3.7e-21 PF01037: AsnC_trans_reg" amino acids 88 to 158 (71 residues), 51.7 bits, see alignment E=9.8e-18

Best Hits

Swiss-Prot: 45% identical to LRP_SALTY: Leucine-responsive regulatory protein (lrp) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1802)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVH3 at UniProt or InterPro

Protein Sequence (168 amino acids)

>Psyr_1802 transcriptional regulator, AsnC family (Pseudomonas syringae pv. syringae B728a)
MKAINERTKKSGADVTPLLDRIDRAILKTLQRDASISNVALAEKVKLSPPACLRRVERLK
EAGVIKGVVALLNGDVLDAGMVVLIGVVLDRSTPDSFAQFEAAAQKVSGCMEFHVVTGEF
DYFMLLRTRDSQSFNRLHAEQLLYLPGVRQIRSFMGLRQVVSTTQLPL