Protein Info for Psyr_1799 in Pseudomonas syringae pv. syringae B728a

Annotation: Protein of unknown function DUF6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 80 to 103 (24 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 227 to 249 (23 residues), see Phobius details amino acids 259 to 277 (19 residues), see Phobius details amino acids 283 to 301 (19 residues), see Phobius details PF00892: EamA" amino acids 28 to 153 (126 residues), 51.5 bits, see alignment E=5.9e-18 amino acids 166 to 301 (136 residues), 43.7 bits, see alignment E=1.6e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to psb:Psyr_1799)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q4ZVH6 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Psyr_1799 Protein of unknown function DUF6 (Pseudomonas syringae pv. syringae B728a)
MNPYLSIAPSVSRPAWHQAIPLPLLEAALVLTWSSGFVGARFSLDHAPPLLVVFWRCVVV
TLILLPFVARQLRSIPAATLLKNAGIGLLAMTGYVAGVTQGIALGVPAGLAALFADLLPM
GMALLAAVVLGQRLAWPIWAGLFVGLIGVVLVTYSALAVGDAPLWAYGLPLLGMFSLAIA
TLWQKQSGTAQPMALLPNLWLQCAVSSVAFAIIQGTQGRLAPVASTGFALSVLWTVGLAT
LGGYGLYWVCLRRASATRVASVLYLSPPVTMLWAWAMFDEPLSWQMASGMAVSGIGVWMV
VRAEQRQSAS